Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated)

Name: Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated)
SKU: SPR-537
Availability: InStock

Human Recombinant Alpha Synuclein (1-114) PFFs (C-terminal Truncated)

Catalog No. SPR-537

0 out of 5 based on 0 customer ratings

Reviews (0) | Datasheet

Expression System	E. coli
Tags	No tag

SKU: SPR-537 Category: Proteins

Size

Clear

Bulk Quote

Sedimentation assay of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (SPR-537)

Seeding Assay of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (SPR-537)

Dot Blot of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (SPR-537)

TEM of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (SPR-537)

SDS-Page of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (SPR-537)

Product Name Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated)

Description

Human Recombinant Alpha Synuclein (1-114) PFFs (C-terminal Truncated)

Applications In vitro Assay, In vivo Assay

Concentration 2 mg/mL

Conjugates

No tag

Dylight 488

Overview:

High fluorescence yield
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 1011 g/mol

Dylight 488 Datasheet

Dylight 488 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 493 nm

λ_em = 518 nm

ε_max = 7.0×10⁴

Laser = 488 nm

APC/Cy7

Overview:

High quantum yield
Excellent batch-to-batch reproducibility
Stringently QC tested

APC-Cy7 Datasheet

ACP-Cy7 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 652 nm

λ_em = 790 nm

Laser = 594 or 633 nm

Dylight 350

Overview:

High fluorescence intensity
High photostability
Less pH-sensitive
Excellent solubility in water
Stringently QC tested
Excellent batch-to-batch reproducibility
Molecular weight: 874 g/mol

Dylight 350 Datasheet

Dylight 350 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 353 nm

λ_em = 432 nm

ε_max = 1.5×10⁴

Dylight 405

Overview:

High fluorescence intensity
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 793 g/mol

Dylight 405 Datasheet

Dylight 405 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 400 nm

λ_em = 420 nm

ε_max = 3.0×10⁴

Laser = 405 nm

Dylight 594

Overview:

High fluorescence yield
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 1078 g/mol

Dylight 594 Datasheet

Dylight 594 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 593 nm

λ_em = 618 nm

ε_max = 8.0×10⁴

Laser = 526 nm

Dylight 633

Overview:

High fluorescence yield
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 1066 g/mol

Dylight 633 Datasheet

Dylight 633 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 638 nm

λ_em = 658 nm

ε_max = 1.7×10⁵

Laser = 633 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex
Small phycobiliprotein
Isolated from red algae
Large stokes shift (195 nm)
Molecular Weight: 35 kDa
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

PerCP Datasheet

PerCP Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield
High photostability
Very hydrophilic
Excellent solubility in water
Very little aggregation

PE/ATTO 594 Datasheet

PE-ATTO 594 Fluorophore Conjugate Excitation and Emission Spectra

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield
High rate of photobleaching
Good solubility in water
Broad emission spectrum
pH dependent spectra
Molecular formula: C₂₀H₁₂O₅
Molar mass: 332.3 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

FITC-Fluorescent-conjugate

FITC Fluorescein Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

ATTO 700

Overview:

High fluorescence yield
Excellent thermal and photostability
Quenched by electron donors
Very hydrophilic
Good solubility in polar solvents
Zwitterionic dye
Molar Mass: 575 g/mol

ATTO 700 Datasheet

ATTO 700 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

ATTO 680

Overview:

High fluorescence yield
Excellent thermal and photostability
Quenched by electron donors
Very hydrophilic
Good solubility in polar solvents
Zwitterionic dye
Molar Mass: 631 g/mol

ATTO 680 Datasheet

ATTO 680 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 655

Overview:

High fluorescence yield
High thermal and photostability
Excellent ozone resistance
Quenched by electron donors
Very hydrophilic
Good solubility in polar solvents
Zwitterionic dye
Molar Mass: 634 g/mol

ATTO 655 Datasheet

ATTO 655 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 633

Overview:

High fluorescence yield
High thermal and photostability
Moderately hydrophilic
Good solubility in polar solvents
Stable at pH 4 – 11
Cationic dye, perchlorate salt
Molar Mass: 652.2 g/mol

ATTO 633 Datasheet

ATTO 633 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 594

Overview:

High fluorescence yield
High photostability
Very hydrophilic
Excellent solubility in water
Very little aggregation
New dye with net charge of -1
Molar Mass: 1137 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

ATTO 594 Datasheet

ATTO 594 Fluorophore Excitation and Emission Spectrum

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 565

Overview:

High fluorescence yield
High thermal and photostability
Good solubility in polar solvents
Excellent solubility in water
Very little aggregation
Rhodamine dye derivative
Molar Mass: 611 g/mol

ATTO 565 Datasheet

ATTO 565 Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 488

Overview:

High fluorescence yield
High photostability
Very hydrophilic
Excellent solubility in water
Very little aggregation
New dye with net charge of -1
Molar Mass: 804 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

ATTO 488 Datasheet

ATTO 488 Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 390

Overview:

High fluorescence yield
Large Stokes-shift (89 nm)
Good photostability
Moderately hydrophilic
Good solubility in polar solvents
Coumarin derivate, uncharged
Low molar mass: 343.42 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

ATTO 390 Datasheet

ATTO 390 Fluorescent Dye Excitation and Emission Spectra

Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

APC (Allophycocyanin)

Overview:

High quantum yield
Large phycobiliprotein
6 chromophores per molecule
Isolated from red algae
Molecular Weight: 105 kDa
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

APC Datasheet

APC Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
Molecular weight: 53 kDa
Formula: C₁₀H₁₆N₂O₃S
Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity
Molar mass: 244.31 g/mol
Formula: C₁₀H₁₆N₂O₃S
Applications: Western blot, immunohistochemistry, and ELISA*

*The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

Biotin Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target
Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors
Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
High turnover rate enables rapid generation of a strong signal
44 kDa glycoprotein
Extinction coefficient: 100 (403 nm)
Applications: Western blot, immunohistochemistry, and ELISA*
- *The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

HRP Datasheet

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
Molecular weight: 140 kDa
Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum
High quantum yield
Photostable
Member of the phycobiliprotein family
Isolated from red algae
Excellent solubility in water
Molecular Weight: 250 kDa

Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

R-PE Datasheet

R-PE Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

Nature Recombinant

Species Human

Expression System E. coli

Amino Acid Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILE

Purity >95%

Other Resources

Protein Length 114 amino acids

Protein Size 11.46 kDa

Field of Use Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.

Properties

Storage Buffer	PBS pH 7.4
Storage Temperature	-80ºC
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Purification	Ion-exchange Purified
Cite This Product	Human Recombinant Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (StressMarq Biosciences \| Victoria, BC CANADA \| Catalog# SPR-537)
Certificate of Analysis	Starting Monomers certified > 95% pure via SDS-PAGE and A260/A280 ratio.
Other Relevant Information	For corresponding monomers, see Catalog # SPR-536.

Biological Description

Alternative Names	α‑Synuclein (1–114), Alpha Synuclein 1‑114 Truncated, C‑Terminally Truncated Alpha‑Synuclein, Alpha‑Synuclein Fragment (1–114), SNCA (1–114) Fibrillar Protein, SNCA (1–114) Protein, Alpha‑Synuclein Fragment 1–114, Seeding‑Competent Alpha‑Synuclein (1–114) Fibrils, Alpha‑Synuclein (1–114) Aggregation Seeds
Research Areas	Neurodegeneration, Neuroscience, Parkinson's Disease, Synuclein
Swiss Prot	P37840
Scientific Background	Human recombinant alpha-synuclein (1–114) is a C-terminally truncated form of α-synuclein lacking residues 115–140. C-terminal truncation is a pathological modification observed in synucleinopathies, including Parkinson’s disease and dementia with Lewy bodies, and has been associated with increased aggregation and fibril formation relative to the full-length protein. Cleavage at residue Glu114 has been identified as a major physiological processing event of α-synuclein aggregates, and the resulting 1–114 species has been detected in disease-associated inclusions. Studies suggest that truncation of the C-terminal region alters α-synuclein conformation and promotes the formation of aggregation-prone species that may contribute to the development and progression of α-synuclein pathology. StressMarq’s Alpha Synuclein (1-114) Pre-Formed Fibrils (PFFs) (C-Term Truncated) have been demonstrated to seed monomers in an in-vitro Thioflavin T seeding assay.
References	1. Quintin, S., Lloyd, G. M., Paterno, G., Xia, Y., Sorrentino, Z., Bell, B. M., Gorion, K-M., Lee, E. B., Prokop, S., Giasson, B. I. (2023). Cellular processing of α-synuclein fibrils results in distinct physiological C-terminal truncations with a major cleavage site at residue Glu114. Journal of Biological Chemistry, 299(7), 104912. https://doi.org/10.1016/j.jbc.2023.104912 2. Sorrentino, Z. A., Vijayaraghavan, N., Gorion, K-M., Riffe, C. J., Strang, K. H., Caldwell, J., & Giasson, B. I. (2018). Physiological C-terminal truncation of α-synuclein potentiates the prion-like formation of pathological inclusions. Journal of Biological Chemistry, 293(49), 18914–18932. https://doi.org/10.1074/jbc.RA118.005603 3. Zhang, C., Pei, Y., Zhang, Z., Xu, L., Liu, X., Jiang, L., Peilak, G. J., Zhou, X., Liu, M., Li, C. (2022). C-terminal truncation modulates α-Synuclein’s cytotoxicity and aggregation by promoting the interactions with membrane and chaperone. Communications Biology, 5, 798. https://doi.org/10.1038/s42003-022-03768-0

Product Images

<p>Representative TEM image of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated), 200nm scale. Negative stain transmission electron microscopy images of Catalog # SPR-537 acquired at 200kX on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain.</p>

Representative TEM image of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated), 200nm scale. Negative stain transmission electron microscopy images of Catalog # SPR-537 acquired at 200kX on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain.

<p>Sedimentation assay on Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated). Samples were spun down at 15,000 x g, washed, and then spun down again. Fibril samples are prepared in denaturing conditions prior to running on the gel. SDS-PAGE analysis on a 12% Bis-Tris gel shows that the majority of the fibril is insoluble.</p>

Sedimentation assay on Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated). Samples were spun down at 15,000 x g, washed, and then spun down again. Fibril samples are prepared in denaturing conditions prior to running on the gel. SDS-PAGE analysis on a 12% Bis-Tris gel shows that the majority of the fibril is insoluble.

<p>In vitro seeding activity of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) in ThT assay. Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (Cat # SPR-537) seed fibril formation of Alpha Synuclein (1-114) Monomers (C-term Truncated) (Cat # SPR-536) over 72 hours. Reactions (100uL) shaken at 600 rpm in Greiner-Bio 96 Well Non-Binding Cell Culture Microplates, Black (Greiner-Bio Catalog #655900) at 37oC in the presence of 25 uM ThT and read with an XPS Microplate Reader set at 450nmex/485nmem.</p>

In vitro seeding activity of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) in ThT assay. Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated) (Cat # SPR-537) seed fibril formation of Alpha Synuclein (1-114) Monomers (C-term Truncated) (Cat # SPR-536) over 72 hours. Reactions (100uL) shaken at 600 rpm in Greiner-Bio 96 Well Non-Binding Cell Culture Microplates, Black (Greiner-Bio Catalog #655900) at 37oC in the presence of 25 uM ThT and read with an XPS Microplate Reader set at 450nmex/485nmem.

<p>Dot Blot analysis using Stressmarq’s SMC-621 and SPC-800 comparing detection of C-terminal truncated Alpha Synuclein Monomers (Cat # SPR-536) and Pre-Formed Fibrils (Cat # SPR-537) with full-length Alpha Synuclein Monomers (Cat # SPR-321). Protein was blotted on nitrocellulose, incubated with 1:1000 primary antibodies and/or 1:4000 secondary antibodies. Secondary controls are goat-anti mouse:HRP or goat-anti rabbit:HRP. Exposed 1 second.</p>

Dot Blot analysis using Stressmarq’s SMC-621 and SPC-800 comparing detection of C-terminal truncated Alpha Synuclein Monomers (Cat # SPR-536) and Pre-Formed Fibrils (Cat # SPR-537) with full-length Alpha Synuclein Monomers (Cat # SPR-321). Protein was blotted on nitrocellulose, incubated with 1:1000 primary antibodies and/or 1:4000 secondary antibodies. Secondary controls are goat-anti mouse:HRP or goat-anti rabbit:HRP. Exposed 1 second.

Representative TEM image of Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated), 200nm scale. Negative stain transmission electron microscopy images of Catalog # SPR-537 acquired at 100kX on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain.

SDS-PAGE analysis of purified starting monomers (pre-fibrillization) on a 12% Bis-Tris gel.

Reviews

There are no reviews yet.

Be the first to review “Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated)”

Alpha Synuclein (1-114) Pre-formed Fibrils (C-term Truncated)

Streptavidin

Biotin

HRP (Horseradish peroxidase)

AP (Alkaline Phosphatase)

Properties

Biological Description

Product Images

Reviews

Reviews

Product Citations