Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers

Name: Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers
SKU: SPR-533
Availability: InStock

Human Synthetic Amyloid Beta Peptide 1-40 + C-terminal Cysteine Monomers

Catalog No. SPR-533

0 out of 5 based on 0 customer ratings

Reviews (0) | Datasheet

Expression System	Synthetic
Tags	No tag

SKU: SPR-533 Category: Proteins

Size

Clear

Bulk Quote

Product Name Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers

Description

Human Synthetic Amyloid Beta Peptide 1-40 + C-terminal Cysteine Monomers

Applications WB, SDS-PAGE

Concentration 1 mg/ml

Conjugates

No tag

Dylight 488

Overview:

High fluorescence yield
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 1011 g/mol

Dylight 488 Datasheet

Dylight 488 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 493 nm

λ_em = 518 nm

ε_max = 7.0×10⁴

Laser = 488 nm

APC/Cy7

Overview:

High quantum yield
Excellent batch-to-batch reproducibility
Stringently QC tested

APC-Cy7 Datasheet

ACP-Cy7 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 652 nm

λ_em = 790 nm

Laser = 594 or 633 nm

Dylight 350

Overview:

High fluorescence intensity
High photostability
Less pH-sensitive
Excellent solubility in water
Stringently QC tested
Excellent batch-to-batch reproducibility
Molecular weight: 874 g/mol

Dylight 350 Datasheet

Dylight 350 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 353 nm

λ_em = 432 nm

ε_max = 1.5×10⁴

Dylight 405

Overview:

High fluorescence intensity
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 793 g/mol

Dylight 405 Datasheet

Dylight 405 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 400 nm

λ_em = 420 nm

ε_max = 3.0×10⁴

Laser = 405 nm

Dylight 594

Overview:

High fluorescence yield
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 1078 g/mol

Dylight 594 Datasheet

Dylight 594 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 593 nm

λ_em = 618 nm

ε_max = 8.0×10⁴

Laser = 526 nm

Dylight 633

Overview:

High fluorescence yield
High photostability
Less pH-sensitive
Excellent batch-to-batch reproducibility
Stringently QC tested
Molecular weight: 1066 g/mol

Dylight 633 Datasheet

Dylight 633 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 638 nm

λ_em = 658 nm

ε_max = 1.7×10⁵

Laser = 633 nm

PerCP

Overview:

Peridinin-Chlorophyll-Protein Complex
Small phycobiliprotein
Isolated from red algae
Large stokes shift (195 nm)
Molecular Weight: 35 kDa
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

PerCP Datasheet

PerCP Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 482 nm

λ_em = 677 nm

ε_max = 1.96 x 10⁶

Laser = 488 nm

PE/ATTO 594

PE/ATTO 594 is a tandem conjugate, where PE is excited at 535 nm and transfers energy to ATTO 594 via FRET (fluorescence resonance energy transfer), which emits at 627 nm.

Overview:

High fluorescence yield
High photostability
Very hydrophilic
Excellent solubility in water
Very little aggregation

PE/ATTO 594 Datasheet

PE-ATTO 594 Fluorophore Conjugate Excitation and Emission Spectra

Optical Properties:

λ_ex = 535 nm

λ_em = 627 nm

Laser = 488 to 561 nm

FITC (Fluorescein)

Overview:

Excellent fluorescence quantum yield
High rate of photobleaching
Good solubility in water
Broad emission spectrum
pH dependent spectra
Molecular formula: C₂₀H₁₂O₅
Molar mass: 332.3 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

FITC-Fluorescent-conjugate

FITC Fluorescein Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 494 nm

λ_em = 520 nm

ε_max = 7.3×10⁴

Φ_f = 0.92

τ_fl = 5.0 ns

Brightness = 67.2

Laser = 488 nm

Filter set = FITC

ATTO 700

Overview:

High fluorescence yield
Excellent thermal and photostability
Quenched by electron donors
Very hydrophilic
Good solubility in polar solvents
Zwitterionic dye
Molar Mass: 575 g/mol

ATTO 700 Datasheet

ATTO 700 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 700 nm

λ_em = 719 nm

ε_max = 1.25×10⁵

Φ_f = 0.25

τ_fl = 1.6 ns

Brightness = 31.3

Laser = 676 nm

Filter set = Cy®5.5

ATTO 680

Overview:

High fluorescence yield
Excellent thermal and photostability
Quenched by electron donors
Very hydrophilic
Good solubility in polar solvents
Zwitterionic dye
Molar Mass: 631 g/mol

ATTO 680 Datasheet

ATTO 680 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 680 nm

λ_em = 700 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.7 ns

Brightness = 37.5

Laser = 633 – 676 nm

Filter set = Cy®5.5

ATTO 655

Overview:

High fluorescence yield
High thermal and photostability
Excellent ozone resistance
Quenched by electron donors
Very hydrophilic
Good solubility in polar solvents
Zwitterionic dye
Molar Mass: 634 g/mol

ATTO 655 Datasheet

ATTO 655 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 663 nm

λ_em = 684 nm

ε_max = 1.25×10⁵

Φ_f = 0.30

τ_fl = 1.8 ns

Brightness = 37.5

Laser = 633 – 647 nm

Filter set = Cy®5

ATTO 633

Overview:

High fluorescence yield
High thermal and photostability
Moderately hydrophilic
Good solubility in polar solvents
Stable at pH 4 – 11
Cationic dye, perchlorate salt
Molar Mass: 652.2 g/mol

ATTO 633 Datasheet

ATTO 633 Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 629 nm

λ_em = 657 nm

ε_max = 1.3×10⁵

Φ_f = 0.64

τ_fl = 3.2 ns

Brightness = 83.2

Laser = 633 nm

Filter set = Cy®5

ATTO 594

Overview:

High fluorescence yield
High photostability
Very hydrophilic
Excellent solubility in water
Very little aggregation
New dye with net charge of -1
Molar Mass: 1137 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

ATTO 594 Datasheet

ATTO 594 Fluorophore Excitation and Emission Spectrum

Optical Properties:

λ_ex = 601 nm

λ_em = 627 nm

ε_max = 1.2×10⁵

Φ_f = 0.85

τ_fl = 3.5 ns

Brightness = 102

Laser = 594 nm

Filter set = Texas Red®

ATTO 565

Overview:

High fluorescence yield
High thermal and photostability
Good solubility in polar solvents
Excellent solubility in water
Very little aggregation
Rhodamine dye derivative
Molar Mass: 611 g/mol

ATTO 565 Datasheet

ATTO 565 Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 563 nm

λ_em = 592 nm

ε_max = 1.2×10⁵

Φ_f = 0.9

τ_fl = 3.4 n

Brightness = 10

Laser = 532 nm

Filter set = TRITC

ATTO 488

Overview:

High fluorescence yield
High photostability
Very hydrophilic
Excellent solubility in water
Very little aggregation
New dye with net charge of -1
Molar Mass: 804 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

ATTO 488 Datasheet

ATTO 488 Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 501 nm

λ_em = 523 nm

ε_max = 9.0×10⁴

Φ_f = 0.80

τ_fl = 4.1 ns

Brightness = 72

Laser = 488 nm

Filter set = FITC

ATTO 390

Overview:

High fluorescence yield
Large Stokes-shift (89 nm)
Good photostability
Moderately hydrophilic
Good solubility in polar solvents
Coumarin derivate, uncharged
Low molar mass: 343.42 g/mol
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

ATTO 390 Datasheet

ATTO 390 Fluorescent Dye Excitation and Emission Spectra

Optical Properties:

λ_ex = 390 nm

λ_em = 479 nm

ε_max = 2.4×10⁴

Φ_f = 0.90

τ_fl = 5.0 ns

Brightness = 21.6

Laser = 365 or 405 nm

APC (Allophycocyanin)

Overview:

High quantum yield
Large phycobiliprotein
6 chromophores per molecule
Isolated from red algae
Molecular Weight: 105 kDa
Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

APC Datasheet

APC Fluorophore Absorption and Emission Spectrum

Optical Properties:

λ_ex = 650 nm

λ_em = 660 nm

ε_max = 7.0×10⁵

Φ_f = 0.68

Brightness = 476

Laser = 594 or 633 nm

Filter set = Cy®5

Streptavidin

Properties:

Homo-tetrameric protein purified from Streptomyces avidinii which binds four biotin molecules with extremely high affinity
Molecular weight: 53 kDa
Formula: C₁₀H₁₆N₂O₃S
Applications: Western blot, immunohistochemistry, and ELISA

Streptavidin Datasheet

Biotin

Properties:

Binds tetrameric avidin proteins including Streptavidin and neuravidin with very high affinity
Molar mass: 244.31 g/mol
Formula: C₁₀H₁₆N₂O₃S
Applications: Western blot, immunohistochemistry, and ELISA*

*The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

Biotin Datasheet

HRP (Horseradish peroxidase)

Properties:

Enzymatic activity is used to amplify weak signals and increase visibility of a target
Readily combines with hydrogen peroxide (H₂O₂) to form HRP-H₂O₂ complex which can oxidize various hydrogen donors
Catalyzes the conversion of:
- Chromogenic substrates (e.g. TMB, DAB, ABTS) into coloured products
- Chemiluminescent substrates (e.g. luminol and isoluminol) into light emitting products via enhanced chemiluminescence (ECL)
- Fluorogenic substrates (e.g. tyramine, homovanillic acid, and 4-hydroxyphenyl acetic acid) into fluorescent products
High turnover rate enables rapid generation of a strong signal
44 kDa glycoprotein
Extinction coefficient: 100 (403 nm)
Applications: Western blot, immunohistochemistry, and ELISA*
- *The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

HRP Datasheet

AP (Alkaline Phosphatase)

Properties:

Broad enzymatic activity for phosphate esters of alcohols, amines, pyrophosphate, and phenols
Commonly used to dephosphorylate the 5’-termini of DNA and RNA to prevent self-ligation
Catalyzes the conversion of:
- Chromogenic substrates (e.g. pNPP, naphthol AS-TR phosphate, BCIP) into coloured products
- Fluorogenic substrates (e.g. 4-methylumbelliferyl phosphate) into fluorescent products
Molecular weight: 140 kDa
Applications: Western blot, immunohistochemistry, and ELISA

AP Datasheet

R-PE (R-Phycoerythrin)

Overview:

Broad excitation spectrum
High quantum yield
Photostable
Member of the phycobiliprotein family
Isolated from red algae
Excellent solubility in water
Molecular Weight: 250 kDa

Applications: The listed applications provide a general overview of potential uses for conjugated antibodies. However, they do not guarantee that every antibody-conjugate combination has been tested or validated for these specific applications.

R-PE Datasheet

R-PE Fluorophore Excitation and Emission Spectra

Optical Properties:

λ_ex = 565 nm

λ_em = 575 nm

ε_max = 2.0×10⁶

Φ_f = 0.84

Brightness = 1.68 x 10³

Laser = 488 to 561 nm

Filter set = TRITC

Nature Synthetic

Species Human

Expression System Synthetic

Amino Acid Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC

Purity >95%

Other Resources

Protein Length 41 amino acids

Protein Size 4.5 kDa

Field of Use Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.

Properties

Storage Buffer	PB pH7.4, 10mM NaCl
Storage Temperature	-80ºC
Shipping Temperature	Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.
Purification	N/A
Cite This Product	Human Synthetic Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers (StressMarq Biosciences \| Victoria, BC CANADA \| Catalog# SPR-533)
Certificate of Analysis	Certified > 95% pure using mass spec and HPLC

Biological Description

Alternative Names	Aβ 1-40-Cys, AB40-C, Amyloid beta 1-40-C, Beta-amyloid peptide (1-40) with cysteine, APP40-Cys, BAPP40-Cys, Modified Aβ40, Amyloid-beta (A4) precursor protein, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide (CVAP), Protease nexin-II (PN-II)
Research Areas	Alzheimer's Disease, Amyloid, Neurodegeneration, Neuroscience
Cellular Localization	Protein certified > 95% pure via SDS-PAGE and nanodrop analysis. Low endotoxin (< 5 EU/mL) at 2 & 5 mg/mL.
Gene ID	351
Swiss Prot	P05067
Scientific Background	Amyloid Beta Peptide 1‑40 (Aβ40) is a predominant 40‑residue isoform generated from proteolytic cleavage of the amyloid precursor protein (APP) and is widely studied for its contribution to Alzheimer’s disease (AD) pathology. Although Aβ40 aggregates more slowly than Aβ42, it remains a key driver of early oligomerization, membrane interactions, and oxidative stress, all of which contribute to synaptic dysfunction and neurodegeneration. Aβ40 also participates in liquid–liquid phase separation and membrane‑assisted aggregation pathways, highlighting its mechanistic relevance to amyloid fibril formation and cellular toxicity. C‑terminal modifications of Aβ40 provide insight into structure–function relationships, as cysteine substitutions in terminal regions do not disrupt fibril architecture and can serve as strategic handles for biochemical labeling and structural interrogation. Studies using cysteine‑modified Aβ40 variants demonstrate that terminal residues remain solvent‑exposed and amenable to thiol‑reactive conjugation, supporting their utility in mechanistic aggregation studies. StressMarq’s Aβ40 + C‑terminal Cysteine Monomers exploit this property by incorporating a C‑terminal cysteine specifically designed for maleimide‑based conjugation. This enables researchers to attach fluorophores, biotin, spin labels, nanoparticles, or crosslinkers without perturbing the core amyloidogenic region, providing a powerful platform for tracking monomer behavior, quantifying aggregation kinetics, and visualizing early oligomerization events. The monomers appear as a single band at the expected molecular weight on SDS‑PAGE and Western blot, enabling reproducibility and consistency across assays. By pairing the biological relevance of Aβ40 with a strategically engineered cysteine residue, Aβ40‑Cys monomers significantly enhance experimental precision in AD research—supporting studies on aggregation mechanisms, membrane interactions, neurotoxicity, biomarker development, and therapeutic screening.
References	1.,Ghosh, P., Narang, K., & Iyer, P. K. (2024). Role of Amyloid Beta in Neurodegeneration and Therapeutic Strategies for Neuroprotection. Methods in molecular biology (Clifton, N.J.), 2761, 337–354. https://doi.org/10.1007/978-1-0716-3662-6_25 2.,Huang, Y., et al. (2024). Regulation of cell distancing in peri-plaque glial nets by Plexin-B1 affects glial activation and amyloid compaction in Alzheimer’s disease. Nature Neuroscience, 27, 1489–1504. https://doi.org/10.1038/s41593-024-01664-w 3.,Mirdha L. (2024). Aggregation Behavior of Amyloid Beta Peptide Depends Upon the Membrane Lipid Composition. The Journal of membrane biology, 257(3-4), 151–164. https://doi.org/10.1007/s00232-024-00314-3

Product Images

<p>SDS-PAGE analysis of Human Synthetic Amyloid Beta 1-40 C-Term Cysteine Monomers on a 4-12% Bis-Tris gel (left). Western Blot of Human Synthetic Amyloid Beta Peptide 1-40 C-Term Cysteine Monomers using an anti-amyloid beta 1-16 monoclonal antibody [6E10] (Biolegend Cat # 803012) at 1:1000. Secondary antibody was a goat anti-mouse:HRP at 1:4000. Exposed 1 second (right).</p>

SDS-PAGE analysis of Human Synthetic Amyloid Beta 1-40 C-Term Cysteine Monomers on a 4-12% Bis-Tris gel (left). Western Blot of Human Synthetic Amyloid Beta Peptide 1-40 C-Term Cysteine Monomers using an anti-amyloid beta 1-16 monoclonal antibody [6E10] (Biolegend Cat # 803012) at 1:1000. Secondary antibody was a goat anti-mouse:HRP at 1:4000. Exposed 1 second (right).

Reviews

There are no reviews yet.

Be the first to review “Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers”

Amyloid Beta Peptide 1-40 + C-term Cysteine Monomers

Streptavidin

Biotin

HRP (Horseradish peroxidase)

AP (Alkaline Phosphatase)

Properties

Biological Description

Product Images

Reviews

Reviews

Product Citations